PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013603082.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 279aa    MW: 32183.4 Da    PI: 4.6268
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013603082.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
   XP_013603082.1 16 RGPWSQDEDLKLISFIHKYGHENWRSLPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding52.61.1e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e ++++++ +G++ W++Ia++++ gRt++++k+ w+++l
   XP_013603082.1  69 RGNFTLEEEETIIKLHQSFGNK-WSKIASKLP-GRTDNEIKNVWHTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-24766IPR009057Homeodomain-like
PROSITE profilePS5129415.3411163IPR017930Myb domain
SuperFamilySSF466892.6E-2914110IPR009057Homeodomain-like
SMARTSM007172.4E-131565IPR001005SANT/Myb domain
PfamPF002491.5E-151663IPR001005SANT/Myb domain
CDDcd001671.11E-91863No hitNo description
PROSITE profilePS5129425.52964118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-2767118IPR009057Homeodomain-like
SMARTSM007171.0E-1468116IPR001005SANT/Myb domain
PfamPF002494.7E-1569114IPR001005SANT/Myb domain
CDDcd001677.60E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGKGRAPCCD KTKVKRGPWS QDEDLKLISF IHKYGHENWR SLPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTLEEEETI IKLHQSFGNK WSKIASKLPG RTDNEIKNVW HTHLKKRLNS  120
YINHNASDEA ASKGSLNKEE TSQESSPNAS RSFGGSNIVS KEEEDDVQIG ETFEYFQDYS  180
ELAGLLQEVD KPELLEIPFD IDPDVWNFLE GFQQPENSLT PKDHQESEED EVDKWFKNLE  240
SELGLEEDDS QQQQEQNNEA KEDSPSPSLL ESYEVLINH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25161207110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756540.0KM975654.1 Brassica napus MYB transcription factor 58.1 (MYB58.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603082.10.0PREDICTED: myb-related protein Myb4
RefseqXP_013710348.10.0PREDICTED: myb-related protein Myb4-like
SwissprotP200243e-69MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0D3DWZ90.0A0A0D3DWZ9_BRAOL; Uncharacterized protein
TrEMBLA0A078D0J50.0A0A078D0J5_BRANA; BnaC08g38370D protein
STRINGBra026720.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.11e-144myb domain protein 58